PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr7P09730_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 300aa    MW: 34437.9 Da    PI: 6.1895
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr7P09730_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.44.9e-1883136356
                            --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
               Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                            k++++t+eq++ Le+ Fe ++++  e++ ++Ak lgL+ rq+ +WFqNrRa++k
  GSMUA_Achr7P09730_001  83 KKRRLTAEQVQFLEKSFEFENKLEPERKLRIAKFLGLKPRQIAIWFQNRRARWK 136
                            56789************************************************9 PP

2HD-ZIP_I/II123.11.3e-3982172191
            HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 
                            ekkrrl++eqv++LE+sFe e+kLeperK ++a+ Lgl+prq+a+WFqnrRAR+ktkqlEkdyeaLk++y +lk ++ rL ke+eeL+
  GSMUA_Achr7P09730_001  82 EKKRRLTAEQVQFLEKSFEFENKLEPERKLRIAKFLGLKPRQIAIWFQNRRARWKTKQLEKDYEALKSSYHNLKMDHGRLLKEKEELE 169
                            69*************************************************************************************9 PP

            HD-ZIP_I/II  89 eel 91 
                             e+
  GSMUA_Achr7P09730_001 170 IEV 172
                            765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.57E-1975140IPR009057Homeodomain-like
PROSITE profilePS5007116.94178138IPR001356Homeobox domain
SMARTSM003897.0E-1881142IPR001356Homeobox domain
PfamPF000462.3E-1583136IPR001356Homeobox domain
CDDcd000863.61E-1683139No hitNo description
Gene3DG3DSA:1.10.10.604.2E-1884145IPR009057Homeodomain-like
PROSITE patternPS000270113136IPR017970Homeobox, conserved site
PfamPF021833.3E-14138179IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MAGRWRDGSS STAVLLQREA TYKEYAGQLL APGTPTGGSL GSWCLATLKD GYGSSPDRPL  60
FRPIELEEID DDESDELLHQ PEKKRRLTAE QVQFLEKSFE FENKLEPERK LRIAKFLGLK  120
PRQIAIWFQN RRARWKTKQL EKDYEALKSS YHNLKMDHGR LLKEKEELEI EVLSLKNKLL  180
MKEKGCMEPF ELNRYPNKLR NSNSNLDTGM KKVHGQTMPC KQEDINSANS TMLDSESAHC  240
IDEGSYSMLM ELTSPSNPFV HVRSDQSQIG EVKACSFSSL QDNSCGSEFH VTEQDLWLWP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1130138RRARWKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009408930.10.0PREDICTED: homeobox-leucine zipper protein HAT5-like
RefseqXP_009408929.10.0PREDICTED: homeobox-leucine zipper protein HAT5-like
TrEMBLM0TG610.0M0TG61_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr7P09730_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP16055714
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.11e-36homeobox 1